PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_67781.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NF-YA
Protein Properties Length: 244aa    MW: 26578.5 Da    PI: 10.6814
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_67781.3genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA102.83.1e-3292148158
     CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                   +ep++VNaKQy++Il+RRq Rakle+++kl  k+rkpylheSRh+hA++R+Rg+gGrF
  MLOC_67781.3  92 EEPMFVNAKQYHAILRRRQIRAKLEAQNKL-VKARKPYLHESRHRHAMKRARGTGGRF 148
                   69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.2E-3790151IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.00191151IPR001289Nuclear transcription factor Y subunit A
PfamPF020453.2E-2793148IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.1E-2494116IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS00686096116IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.1E-24125148IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0009785Biological Processblue light signaling pathway
GO:0010262Biological Processsomatic embryogenesis
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MLTVTLLFVS DNDNDHGKPD QHMIKSLLSL GNPDTVAPPP MLACSQSFAY IPYPADAYAG  60
VFPGYASHAI VHPQLNAATN SRVPLPVEPA AEEPMFVNAK QYHAILRRRQ IRAKLEAQNK  120
LVKARKPYLH ESRHRHAMKR ARGTGGRFLN TKQLEEQKQK QASGGASCTK VLGKNTVLQS  180
SPTFAPLASA PSNMSSFSTT GMLANQERAC FPSLGFRPTV SFAALNGNGK LAPNGMHQRA  240
SMMR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A7e-2492153263NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1132141RHRHAMKRAR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2517790.0AK251779.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf130j12, mRNA sequence.
GenBankAK3705700.0AK370570.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2112K12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010235752.11e-98PREDICTED: nuclear transcription factor Y subunit A-4-like
SwissprotQ9SYH41e-40NFYA5_ARATH; Nuclear transcription factor Y subunit A-5
TrEMBLM0YC550.0M0YC55_HORVD; Uncharacterized protein
STRINGMLOC_67781.11e-175(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54160.12e-35nuclear factor Y, subunit A5